PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.D01346.1.p
Common NameEUGRSUZ_D01346
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family G2-like
Protein Properties Length: 102aa    MW: 11689.9 Da    PI: 10.7667
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.D01346.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.47.6e-342679255
           G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                      prlrWtp+LH++F++aveqLGG+++AtPk +l++m+vkgLt++hvkSHLQ+YR+
  Eucgr.D01346.1.p 26 PRLRWTPDLHQCFMHAVEQLGGEDRATPKMVLQIMSVKGLTISHVKSHLQMYRS 79
                      9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.7052282IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.1E-332281IPR009057Homeodomain-like
SuperFamilySSF466891.79E-172380IPR009057Homeodomain-like
TIGRFAMsTIGR015579.6E-262680IPR006447Myb domain, plants
PfamPF002492.0E-82778IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 102 aa     Download sequence    Send to blast
MLALLPLGTI SRRPSVVRPY VRSKTPRLRW TPDLHQCFMH AVEQLGGEDR ATPKMVLQIM  60
SVKGLTISHV KSHLQMYRSM KHEQIMQGHL YNSTTFLCIF L*
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.D01346.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007026111.15e-43Homeodomain-like superfamily protein
RefseqXP_010647532.17e-43PREDICTED: putative two-component response regulator ARR21
SwissprotQ700D92e-29MYBF_ARATH; Putative Myb family transcription factor At1g14600
TrEMBLA0A059CF661e-70A0A059CF66_EUCGR; Uncharacterized protein
STRINGVIT_00s1624g00010.t016e-44(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36328184
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40260.11e-30G2-like family protein